BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 41fae50fb21d3d581233126d6c4877b0.SwissProt.fasta
           1 sequences; 276 total letters



Query= ACIAD1553

Length=66
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q00462 Probable transposase for insertion sequence element IS702 ...  39.7    5e-10


>Q00462 Probable transposase for insertion sequence element IS702 
[Microchaete diplosiphon]
Length=276

 Score = 39.7 bits (91),  Expect = 5e-10
 Identities = 23/61 (38%), Positives = 32/61 (52%), Gaps = 0/61 (0%)

Query  3    KGAVHNFELFKCNFYVVSKNSFILGDKGYQGIYALYADSLLPSKAKKRCGLYSVPIGYHR  62
            KG +H+F LFK +    S+   ++ DKGYQGI  ++  S  P K  K   L      Y+R
Sbjct  165  KGRIHDFRLFKTSGVKFSELLKVIADKGYQGITKIHKLSETPIKKPKGKKLAKEQKEYNR  224

Query  63   E  63
            E
Sbjct  225  E  225


 Score = 13.5 bits (23),  Expect = 1.1
 Identities = 3/6 (50%), Positives = 6/6 (100%), Gaps = 0/6 (0%)

Query  6    VHNFEL  11
            ++N+EL
Sbjct  267  IYNYEL  272



Lambda      K        H        a         alpha
   0.330    0.145    0.456    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13624


  Database: 41fae50fb21d3d581233126d6c4877b0.SwissProt.fasta
    Posted date:  May 9, 2024  6:09 AM
  Number of letters in database: 276
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40