ACIAD1661 / SwissProt Alignments

BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: e4bfb10a3dcbbb7f878d9c27650745a3.SwissProt.fasta
           1 sequences; 166 total letters



Query= ACIAD1661

Length=181
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C7IZ16 Probable glucosamine 6-phosphate N-acetyltransferase 2 [Or...  35.8    7e-08


>C7IZ16 Probable glucosamine 6-phosphate N-acetyltransferase 2 
[Oryza sativa subsp. japonica]
Length=166

 Score = 35.8 bits (81),  Expect = 7e-08
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query  72   KTAYIEYVTTDSTMRGRGLASKLLMYLINILTTKKYELAALQ--PEVEAFYRKLGWVSWG  129
            K  ++E V  D+  RGRGL  +++  L+ I          L   PE+ A+Y K G+V  G
Sbjct  100  KVGHVEDVVVDAAARGRGLGLRVVRRLVEIAKEAGCYKVILDCTPELRAYYAKCGFVEKG  159

Query  130  GNLYI  134
              + I
Sbjct  160  VQMAI  164



Lambda      K        H        a         alpha
   0.325    0.139    0.435    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 24124


  Database: e4bfb10a3dcbbb7f878d9c27650745a3.SwissProt.fasta
    Posted date:  May 19, 2024  9:24 PM
  Number of letters in database: 166
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40