BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 7136d22065ca9f4c0cf3619a77731bf2.SwissProt.fasta
           1 sequences; 219 total letters



Query= ACIAD1760

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9SUI4 Photosystem I reaction center subunit XI, chloroplastic [A...  32.3    1e-06


>Q9SUI4 Photosystem I reaction center subunit XI, chloroplastic 
[Arabidopsis thaliana]
Length=219

 Score = 32.3 bits (72),  Expect = 1e-06
 Identities = 18/63 (29%), Positives = 31/63 (49%), Gaps = 1/63 (2%)

Query  68   GMMYIPVVVAMAAQQNVVSAITSGHMAVLAAICTVVVCTLTIAGLSRYKKGTPLPKEEIT  127
            G   +   V     +N   A ++G +A    +  + +C LTI G+S +K+G P     +T
Sbjct  112  GFFLVGPFVKAGPLRNTAYAGSAGSLAAAGLVVILSMC-LTIYGISSFKEGEPSIAPSLT  170

Query  128  MTG  130
            +TG
Sbjct  171  LTG  173


 Score = 11.5 bits (18),  Expect = 9.4
 Identities = 6/14 (43%), Positives = 7/14 (50%), Gaps = 0/14 (0%)

Query  6    VGLLALCTLVGVII  19
            VGL     LVG  +
Sbjct  107  VGLAHGFFLVGPFV  120



Lambda      K        H        a         alpha
   0.330    0.145    0.430    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 24120


  Database: 7136d22065ca9f4c0cf3619a77731bf2.SwissProt.fasta
    Posted date:  May 9, 2024  6:40 PM
  Number of letters in database: 219
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40