BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: b3acd80edc679063ade4b4b6290cd595.SwissProt.fasta
           1 sequences; 335 total letters



Query= ACIAD2262

Length=218
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B3EL67 Acetyl-coenzyme A carboxylase carboxyl transferase subunit...  33.9    2e-06


>B3EL67 Acetyl-coenzyme A carboxylase carboxyl transferase subunit 
alpha [Chlorobium phaeobacteroides (strain BS1)]
Length=335

 Score = 33.9 bits (76),  Expect = 2e-06
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 0/56 (0%)

Query  42   DEIIDALLVELVRRFPESDKRETAEKLAGYVKSTVAVLLKQLLSKAPNDIVQQSIE  97
            +++++  +V+ +   P        EK+A  VKS +   L+ LL K P+D+V + IE
Sbjct  268  EDLLEQKIVDRIIPEPLGGAHHDPEKMADTVKSLLVEELRMLLEKNPDDLVNERIE  323


 Score = 13.9 bits (24),  Expect = 4.3
 Identities = 3/6 (50%), Positives = 6/6 (100%), Gaps = 0/6 (0%)

Query  191  IDKLIP  196
            +D++IP
Sbjct  276  VDRIIP  281



Lambda      K        H        a         alpha
   0.321    0.136    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 59830


  Database: b3acd80edc679063ade4b4b6290cd595.SwissProt.fasta
    Posted date:  May 30, 2024  7:12 AM
  Number of letters in database: 335
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40