BLASTP 2.12.0+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.
Database: 6f4a0d625efbf92656dd5847f074679b.SwissProt.fasta
1 sequences; 297 total letters
Query= ACIAD2918
Length=189
Score E
Sequences producing significant alignments: (Bits) Value
C5C246 Mycothiol acetyltransferase [Beutenbergia cavernae (strain... 36.6 1e-07
>C5C246 Mycothiol acetyltransferase [Beutenbergia cavernae (strain
ATCC BAA-8 / DSM 12333 / NBRC 16432)]
Length=297
Score = 36.6 bits (83), Expect = 1e-07
Identities = 16/38 (42%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
Query 117 VSPHARGKGVAKALHDHALHILKAEKFDAMVAFVDAEN 154
V P A+G+G+ +AL D AL +L+A D + +V+ EN
Sbjct 236 VDPGAQGRGLGRALTDRALDVLRARGVDRVELYVEGEN 273
Score = 15.0 bits (27), Expect = 1.4
Identities = 3/9 (33%), Positives = 8/9 (89%), Gaps = 0/9 (0%)
Query 176 ASGQFFIIG 184
A+G+ +++G
Sbjct 227 ATGEIYVLG 235
Lambda K H a alpha
0.324 0.139 0.413 0.792 4.96
Gapped
Lambda K H a alpha sigma
0.267 0.0410 0.140 1.90 42.6 43.6
Effective search space used: 45484
Database: 6f4a0d625efbf92656dd5847f074679b.SwissProt.fasta
Posted date: May 31, 2024 4:18 AM
Number of letters in database: 297
Number of sequences in database: 1
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40