ACIAD2992 / SwissProt Alignments

BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2789f4bf735e3183c334286d12a4471d.SwissProt.fasta
           1 sequences; 138 total letters



Query= ACIAD2992

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

P46235 Probable lactoylglutathione lyase [Vibrio parahaemolyticus...  32.0    6e-07


>P46235 Probable lactoylglutathione lyase [Vibrio parahaemolyticus 
serotype O3:K6 (strain RIMD 2210633)]
Length=138

 Score = 32.0 bits (71),  Expect = 6e-07
 Identities = 22/71 (31%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query  17  MENHQSIIPVLRIFDVDKAKNFYLDFLGFKLDWTHQFEENFPLYMQLSKDQYCLHLTEHY  76
           M N + +  +LR+ D+DK+  FY + +G +L  T++ +E           +Y L     Y
Sbjct  1   MSNGRILHTMLRVGDLDKSIKFYTEVMGMQLLRTNENKEY----------EYTLAFV-GY  49

Query  77  GDCSPGALVRL  87
           GD S GA++ L
Sbjct  50  GDESQGAVIEL  60



Lambda      K        H        a         alpha
   0.327    0.141    0.449    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 15621


  Database: 2789f4bf735e3183c334286d12a4471d.SwissProt.fasta
    Posted date:  May 9, 2024  1:05 PM
  Number of letters in database: 138
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40