Get results CSV file
Prior-Knowledge Description Expectation Prediction Conclusion Leaf Statistics
Evidence_85725 TIGR04333 HMM None - {{∅}} None - {{∅}} Unexplained
Evidence_85726 TIGR04334 HMM None - {{∅}} None - {{∅}} Unexplained
Component_63971 Clo7bot tandem target peptide None - {{∅}} None - {{∅}} Unexplained
GenProp1062 radical SAM/SPASM system Clo7bot~This property features a radical SAM/SPASM domain peptide maturase that, in multiple strains of Clostridium botulinum, is next to a tandem array of seven target peptides, all Cys-rich. This system also occurs in Clostridium sporogenes, and an array of six peptides occurs in Thermoanaerobacter italicus Ab9. Clostridium cellulovorans 743B has a matching radical SAM maturase, but a single weak candidate target sequence, MKFVKAPTKNISIIKCPYFCNTFFPILPPTF. None - {{∅}} None - {{∅}} Unexplained
Component_63972 radical SAM/SPASM domain Clo7bot peptide maturase None - {{∅}} None - {{∅}} Unexplained