![]() |
WARNING!!! | ![]() |
|
The section Annotated Databank File allows the user to choose the input databank file to be analyzed. The input can be a native file directly downloaded from EMBL or GenBank web sites, or an EMBL file generated by the Artemis software.
The parsing step takes into account heterogeneity in databank annotations, and genes annotated as authentic frameshifts (or point mutation) in order to avoid false positive predictions in regions of the genome containing already identified frameshifts. Very often, these regions are annotated using the gene feature only (i.e, at the TIGR center), OR using /pseudo in the CDS feature (i.e, at the Sanger center).
While annotations of the GenBank files are always described with both the gene and CDS features, we have noticed that in the EMBL file format, the gene feature is used only in thirteen cases. Consequently, frameshifted genes being annotated only with the gene feature are missing in the whole annotation of the EMBL file and thus appears as new AMIGene prediction. For example, in the Shewanella oneidensis genome more than 70 genes are supposed to be frameshifted.
In the Genbank file (AE014299) these genes are annotated as follow : gene 1250687..1251130 /gene="rbfA" /note="SO1205" CDS 1250687..1251130 /gene="rbfA" /note="similar to GB:M94547, and PID:189011; identified by sequence similarity; putative" /codon_start=1 /transl_table=11 /product="ribosome-binding factor A" /protein_id="AAN54275.1" /db_xref="GI:24346873" /translation="MAKEFSRTRRIGQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSR DLSYAKVFVTFFEEDKDVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLV EGMRMSNLVSQVINSDKAKQQQFGSVDDDVIENDIEESDDTEGKV" gene 1251130..1252083 /gene="truB" /note="SO1206; This region contains a pseudogene, one or more premature stops, and is not the result of a sequencing artifact; tRNA pseudouridine synthase B; identified by match to TIGR protein family HMM TIGR01465" gene 1252211..1252480 /gene="rpsO" /note="SO1207" CDS 1252211..1252480 /gene="rpsO" /note="identified by match to PFAM protein family HMM PF00312" /codon_start=1 /transl_table=11 /product="ribosomal protein S15" /protein_id="AAN54276.1" /db_xref="GI:24346874" /translation="MSLSTEAKAKILAEFGRGANDTGSTEVQVALLTAQINHLQDHFK EHIHDHHSRRGLLRMVSARRKLLAYLKRTEAVRYNELIQKLGLRR"In the EMBL file, the corresponding gene is missing : FT CDS 1250687..1251130 FT /codon_start=1 FT /db_xref="GOA:Q8EHL4" FT /db_xref="Swiss-Prot:Q8EHL4" FT /note="similar to GB:M94547, and PID:189011; identified by FT sequence similarity; putative" FT /transl_table=11 FT /gene="rbfA" FT /product="ribosome-binding factor A" FT /protein_id="AAN54275.1" FT /translation="MAKEFSRTRRIGQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSRD FT LSYAKVFVTFFEEDKDVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEG FT MRMSNLVSQVINSDKAKQQQFGSVDDDVIENDIEESDDTEGKV" FT CDS 1252211..1252480 FT /codon_start=1 FT /db_xref="GOA:Q8EHL3" FT /db_xref="TrEMBL:Q8EHL3" FT /note="identified by match to PFAM protein family HMM FT PF00312" FT /transl_table=11 FT /gene="rpsO" FT /product="ribosomal protein S15" FT /protein_id="AAN54276.1" FT /translation="MSLSTEAKAKILAEFGRGANDTGSTEVQVALLTAQINHLQDHFKE FT HIHDHHSRRGLLRMVSARRKLLAYLKRTEAVRYNELIQKLGLRR" FT CDS complement(1252572..1254626) FT /codon_start=1 FT /db_xref="GOA:Q8EHL2" FT /db_xref="TrEMBL:Q8EHL2" FT /note="identified by match to PFAM protein family HMM FT PF00672" FT /transl_table=11 FT /gene="SO1208" FT /product="GGDEF domain protein" FT /protein_id="AAN54277.1" FT /translation="MTGRFKSLTWKQTNLVVFTALFFAIAIFIVEIALVVVSTKQQLTT FT TQQELLDSVEQPAANAVWALDDNLARQTLEGAIKVEHVGSAVIELDDGSMFVSVSNNRA FT NNSQTFISLSNQLFDDLKEISRPLYRPFYFEGTQKQQLIGTLTIFYDTQELTNTLFSQL ... // |