ACIAD0056 / SwissProt Alignments

BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 6ecf393bf78ee3e76ecf257992973ab6.SwissProt.fasta
           1 sequences; 590 total letters



Query= ACIAD0056

Length=53
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4J6D9 Glutamine--fructose-6-phosphate aminotransferase [isomeriz...  29.6    2e-06


>Q4J6D9 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 
[Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 
639 / JCM 8929 / NBRC 15157 / NCIMB 11770)]
Length=590

 Score = 29.6 bits (65),  Expect = 2e-06
 Identities = 12/33 (36%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  7    YYLSISREGLNNEPGVVLQTFNFCIKDKDIIYS  39
            + L +SREG+N+ P +  + +NF  K  D+I++
Sbjct  311  FSLLLSREGMNSFPLIASEYYNFKAKKDDLIFA  343


 Score = 16.2 bits (30),  Expect = 0.19
 Identities = 7/11 (64%), Positives = 9/11 (82%), Gaps = 1/11 (9%)

Query  7    YYLSISREGLN  17
            YY S+S+ GLN
Sbjct  567  YYASVSK-GLN  576



Lambda      K        H        a         alpha
   0.329    0.148    0.446    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 20628


  Database: 6ecf393bf78ee3e76ecf257992973ab6.SwissProt.fasta
    Posted date:  Jun 2, 2024  6:20 AM
  Number of letters in database: 590
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40