BLASTP 2.12.0+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.
Database: 74aedf11d862cd787f97fe5176297dc4.SwissProt.fasta
1 sequences; 276 total letters
Query= ACIAD1553
Length=66
Score E
Sequences producing significant alignments: (Bits) Value
Q00462 Probable transposase for insertion sequence element IS702 ... 39.7 5e-10
>Q00462 Probable transposase for insertion sequence element IS702
[Microchaete diplosiphon]
Length=276
Score = 39.7 bits (91), Expect = 5e-10
Identities = 23/61 (38%), Positives = 32/61 (52%), Gaps = 0/61 (0%)
Query 3 KGAVHNFELFKCNFYVVSKNSFILGDKGYQGIYALYADSLLPSKAKKRCGLYSVPIGYHR 62
KG +H+F LFK + S+ ++ DKGYQGI ++ S P K K L Y+R
Sbjct 165 KGRIHDFRLFKTSGVKFSELLKVIADKGYQGITKIHKLSETPIKKPKGKKLAKEQKEYNR 224
Query 63 E 63
E
Sbjct 225 E 225
Score = 13.5 bits (23), Expect = 1.1
Identities = 3/6 (50%), Positives = 6/6 (100%), Gaps = 0/6 (0%)
Query 6 VHNFEL 11
++N+EL
Sbjct 267 IYNYEL 272
Lambda K H a alpha
0.330 0.145 0.456 0.792 4.96
Gapped
Lambda K H a alpha sigma
0.267 0.0410 0.140 1.90 42.6 43.6
Effective search space used: 13624
Database: 74aedf11d862cd787f97fe5176297dc4.SwissProt.fasta
Posted date: May 10, 2024 11:15 AM
Number of letters in database: 276
Number of sequences in database: 1
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40