BLASTP 2.12.0+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.
Database: 8d430296376001d66b5f7317a3412449.SwissProt.fasta
1 sequences; 166 total letters
Query= ACIAD1661
Length=181
Score E
Sequences producing significant alignments: (Bits) Value
C7IZ16 Probable glucosamine 6-phosphate N-acetyltransferase 2 [Or... 35.8 7e-08
>C7IZ16 Probable glucosamine 6-phosphate N-acetyltransferase 2
[Oryza sativa subsp. japonica]
Length=166
Score = 35.8 bits (81), Expect = 7e-08
Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
Query 72 KTAYIEYVTTDSTMRGRGLASKLLMYLINILTTKKYELAALQ--PEVEAFYRKLGWVSWG 129
K ++E V D+ RGRGL +++ L+ I L PE+ A+Y K G+V G
Sbjct 100 KVGHVEDVVVDAAARGRGLGLRVVRRLVEIAKEAGCYKVILDCTPELRAYYAKCGFVEKG 159
Query 130 GNLYI 134
+ I
Sbjct 160 VQMAI 164
Lambda K H a alpha
0.325 0.139 0.435 0.792 4.96
Gapped
Lambda K H a alpha sigma
0.267 0.0410 0.140 1.90 42.6 43.6
Effective search space used: 24124
Database: 8d430296376001d66b5f7317a3412449.SwissProt.fasta
Posted date: Jun 3, 2024 3:16 PM
Number of letters in database: 166
Number of sequences in database: 1
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40