BLASTP 2.12.0+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.
Database: 744fa20780ff9c78b86521663e3c947a.SwissProt.fasta
1 sequences; 335 total letters
Query= ACIAD2262
Length=218
Score E
Sequences producing significant alignments: (Bits) Value
B3EL67 Acetyl-coenzyme A carboxylase carboxyl transferase subunit... 33.9 2e-06
>B3EL67 Acetyl-coenzyme A carboxylase carboxyl transferase subunit
alpha [Chlorobium phaeobacteroides (strain BS1)]
Length=335
Score = 33.9 bits (76), Expect = 2e-06
Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
Query 42 DEIIDALLVELVRRFPESDKRETAEKLAGYVKSTVAVLLKQLLSKAPNDIVQQSIE 97
+++++ +V+ + P EK+A VKS + L+ LL K P+D+V + IE
Sbjct 268 EDLLEQKIVDRIIPEPLGGAHHDPEKMADTVKSLLVEELRMLLEKNPDDLVNERIE 323
Score = 13.9 bits (24), Expect = 4.3
Identities = 3/6 (50%), Positives = 6/6 (100%), Gaps = 0/6 (0%)
Query 191 IDKLIP 196
+D++IP
Sbjct 276 VDRIIP 281
Lambda K H a alpha
0.321 0.136 0.374 0.792 4.96
Gapped
Lambda K H a alpha sigma
0.267 0.0410 0.140 1.90 42.6 43.6
Effective search space used: 59830
Database: 744fa20780ff9c78b86521663e3c947a.SwissProt.fasta
Posted date: Jun 3, 2024 5:15 PM
Number of letters in database: 335
Number of sequences in database: 1
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40