ACIAD2709 / SwissProt Alignments

BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 4a8d391ed8d1467ba49bab32928b0a10.SwissProt.fasta
           1 sequences; 1,026 total letters



Query= ACIAD2709

Length=66
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0RD23 UPF0182 protein FRAAL6027 [Frankia alni (strain DSM 45986 ...  30.8    3e-06


>Q0RD23 UPF0182 protein FRAAL6027 [Frankia alni (strain DSM 45986 
/ CECT 9034 / ACN14a)]
Length=1026

 Score = 30.8 bits (68),  Expect = 3e-06
 Identities = 21/66 (32%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  1    LIGEYNADGVPLVKYICLGDKPV-AATYGAGTTAKTYWITTD-AQNTPRRLINAADGTTT  58
            L G   +DG P      LGD    + T  +G  A+      +  +N+ +  ++A DGT T
Sbjct  584  LDGYTTSDGYPYSARRTLGDVTADSVTAQSGNRARQAANQVNYIRNSVKATVDAYDGTVT  643

Query  59   VWAWDE  64
            ++AWDE
Sbjct  644  LYAWDE  649



Lambda      K        H        a         alpha
   0.323    0.137    0.459    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 43129


  Database: 4a8d391ed8d1467ba49bab32928b0a10.SwissProt.fasta
    Posted date:  May 10, 2024  4:46 PM
  Number of letters in database: 1,026
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40