ACIAD2918 / SwissProt Alignments

BLASTP 2.12.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f0a43eb19805340422147efb048b53f6.SwissProt.fasta
           1 sequences; 297 total letters



Query= ACIAD2918

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C5C246 Mycothiol acetyltransferase [Beutenbergia cavernae (strain...  36.6    1e-07


>C5C246 Mycothiol acetyltransferase [Beutenbergia cavernae (strain 
ATCC BAA-8 / DSM 12333 / NBRC 16432)]
Length=297

 Score = 36.6 bits (83),  Expect = 1e-07
 Identities = 16/38 (42%), Positives = 25/38 (66%), Gaps = 0/38 (0%)

Query  117  VSPHARGKGVAKALHDHALHILKAEKFDAMVAFVDAEN  154
            V P A+G+G+ +AL D AL +L+A   D +  +V+ EN
Sbjct  236  VDPGAQGRGLGRALTDRALDVLRARGVDRVELYVEGEN  273


 Score = 15.0 bits (27),  Expect = 1.4
 Identities = 3/9 (33%), Positives = 8/9 (89%), Gaps = 0/9 (0%)

Query  176  ASGQFFIIG  184
            A+G+ +++G
Sbjct  227  ATGEIYVLG  235



Lambda      K        H        a         alpha
   0.324    0.139    0.413    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 45484


  Database: f0a43eb19805340422147efb048b53f6.SwissProt.fasta
    Posted date:  Jun 1, 2024  9:52 PM
  Number of letters in database: 297
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40